Protein Info for QEN71_RS04480 in Paraburkholderia sabiae LMG 24235

Annotation: molybdopterin-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF03453: MoeA_N" amino acids 20 to 183 (164 residues), 149.4 bits, see alignment E=1.1e-47 TIGR00177: molybdenum cofactor synthesis domain" amino acids 193 to 337 (145 residues), 95.3 bits, see alignment E=1.7e-31 PF00994: MoCF_biosynth" amino acids 198 to 340 (143 residues), 110.6 bits, see alignment E=8.4e-36 PF03454: MoeA_C" amino acids 360 to 427 (68 residues), 67.9 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 46% identical to MOEA_SALTY: Molybdopterin molybdenumtransferase (moeA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 93% identity to bph:Bphy_0815)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>QEN71_RS04480 molybdopterin-binding protein (Paraburkholderia sabiae LMG 24235)
MTTLNETSSCVAQYDAQAMPVSAVQAIVREWAAPVTTVERVHLRDALNRVLAQDIVSPID
VPAHDNSAMDGYAFSGAALEGQSGEIALAVAGKAFAGHPFEGTTDATQCVRVMTGATMPA
GCDTVVPQEAVTREGDTIRFAAQQLRTGANRRLAGEDLAGGAVALKAGRIVRASDLGLLA
SLGIGEVSVRRRLRVAFFSTGDELRSIGEPLDAGCVYDSNRYTLFAMLKRLDVDPIDLGV
VRDEPAALEEALRTAAASADVVITSGGVSVGEADLTKQMLRLLGDVAHWSLAMRPGRPLA
FGRIWSGGKPGAGEPAIFFGLPGNPVAVMAAFYQIVREVLLRMSGATTHAVPLIRAACVE
TIRKRPGRTEFQRGVAQRDAQGAWHVHPTGSQGSGVLSSMSEANCFIVLAHEQSDLDPGD
AVDIMLFDGLI