Protein Info for QEN71_RS04465 in Paraburkholderia sabiae LMG 24235

Annotation: DNA recombination protein RmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF02646: RmuC" amino acids 185 to 476 (292 residues), 245.6 bits, see alignment E=3.1e-77

Best Hits

Swiss-Prot: 53% identical to RMUC_XYLFA: DNA recombination protein RmuC homolog (rmuC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 96% identity to bph:Bphy_0812)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>QEN71_RS04465 DNA recombination protein RmuC (Paraburkholderia sabiae LMG 24235)
MTMVLIAAIAVLAVALVIALALLLRGANAEQQHVYIDELGERLDAAALAQMREFERLERE
LRGEISDTARVSRTELNGGFSQFQQTLAAQFTSMTTVQAGKIDGFAQQLVKLTETNAQQL
EAVRYSFQQQAQQARDEQSVTLTRFGETLQHQLAQVTEANDRRFAEVRAAIEQRLKDIEA
NNATKLEEMRRTVDEKLHATLEQRLGESFKLVSDRLEQVHRGLGEMQTLAAGVGDLKKVL
TNVKTRGTWGEVQLEALLEQILTSDQYAKNVATIPKSNDRVEFAIKLPGRQPSPDAAATP
VWLPIDAKFPREDYERLIEAQERADPVAVEDASRALEGRIRAEARTIADKYVSPPHTTDF
ALLFLPTEGLYAEILRRPGLTDLLQRDYRVTIAGPTTLTALLNSLQMGFRTLAIEQRSSE
VWQVLGAVKTEFGKFGDVLAKTKSQLETVTRSIEAAEVRTRQMNRKLRDVEALPEERAAG
LLGDSLSGVDPDES