Protein Info for QEN71_RS04245 in Paraburkholderia sabiae LMG 24235

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 58 to 309 (252 residues), 210.8 bits, see alignment E=1.2e-66 PF03193: RsgA_GTPase" amino acids 78 to 251 (174 residues), 177.4 bits, see alignment E=1.2e-56

Best Hits

Swiss-Prot: 97% identical to RSGA_PARP8: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 97% identity to bph:Bphy_0776)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>QEN71_RS04245 ribosome small subunit-dependent GTPase A (Paraburkholderia sabiae LMG 24235)
MSGRSPKALRAAAAGDRAQDRVRGLVIAAHGRHYIVASEDGSAILQCFPRGKRSEIAVGD
QVLYEPTSADQGVIVEIGERRNLLYRSDQYKSKLFAANLDQLLIVLATEPHFSEDLLGRA
LVAAEENELKPLIVLNKIDVEAALPLARKRLELYRGLGYTVLEVSIKMQPDAARATLEEH
LHGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPGVEGAL
IDSPGFQEFGLHHLTEGKLERAFPEFRPLLPNCRFYNCHHLHEPGCAILEAVADGRIAKE
RHALYAQLVHEASQIVR