Protein Info for QEN71_RS04110 in Paraburkholderia sabiae LMG 24235

Annotation: lipopolysaccharide assembly protein LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF13432: TPR_16" amino acids 46 to 90 (45 residues), 21.8 bits, see alignment 1.4e-07 amino acids 185 to 247 (63 residues), 34.5 bits, see alignment E=1.4e-11 PF13176: TPR_7" amino acids 73 to 101 (29 residues), 24.6 bits, see alignment (E = 1.1e-08) PF14559: TPR_19" amino acids 190 to 245 (56 residues), 26.7 bits, see alignment 3.3e-09 PF18073: Rubredoxin_2" amino acids 354 to 378 (25 residues), 31.1 bits, see alignment (E = 8.8e-11)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_0749)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>QEN71_RS04110 lipopolysaccharide assembly protein LapB (Paraburkholderia sabiae LMG 24235)
MDLDLWWLLVIPVAFAFGWVAARYDLKALLSESANLPRSYFRGLNFLLNEQPDQAIDAFI
EVVKLDPETIELHFALGNLFRRRGETDRAIRVHQNLLSRADLPVTERDHALYELGQDFLK
AGLLDRAEETFKALESGDYALGAQRALLTIYQIEKDWNKSIDTARRLETMGAASLDKDIG
HFHCELAQEALQQKNPDEARRQLDLALKAHPQNVRATILFGDVDAAAGQYEKAIEQWLRV
EEQNASYLPLVAEKLMKAYEALGRQADGADLLTTWVDRYPSNDLLDVAYQHVSALRGPEA
AHALARTQMQKSPNLAGMTRLLEAQQAVAEEPRRSELELMRTLIRQRTKNLPRYTCQNCG
FRARLFYWQCPGCSGWETYAPRRVEPITASS