Protein Info for QEN71_RS03705 in Paraburkholderia sabiae LMG 24235

Annotation: exonuclease domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF00929: RNase_T" amino acids 16 to 163 (148 residues), 104.6 bits, see alignment E=8.5e-34 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 16 to 170 (155 residues), 75.2 bits, see alignment E=2.6e-25 PF01541: GIY-YIG" amino acids 210 to 282 (73 residues), 23.5 bits, see alignment E=5.5e-09

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 92% identity to bph:Bphy_0677)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>QEN71_RS03705 exonuclease domain-containing protein (Paraburkholderia sabiae LMG 24235)
MSEPFLSEPALDVPIVFVDLETTGGSVGEHRITEVGVVEVGPDGASSWTTLVDPGQPIPP
FIQQLTGITNEMVRGAPTFAAIAAELFARLDGKLFIAHNASFDRGFLRSEFQRAGFAFNP
DVLCTVRLSRALFPAEKRHGLDALVERHALVPSDRHRALADADLIWQYWQRLHGLVPVDV
LRSQIDKTMRRFRLAGDITEDLIDTAPAGCGVYAFYGESDAPLYVGRSVRVRQRLRSHLT
GERRSSKEMKLAQQVRRVEWRATGGEIGALLAEAQLIAALRPPHNRVPRVSRADPVDAPW
PYDGAIAFEERDTAEGGRVFHIVDRWRYLGHAPSLAEAATLLAASVPGAFELATWRILQS
HLARGLQVLPLSRPAALASDAVVLTTAPADAA