Protein Info for QEN71_RS03685 in Paraburkholderia sabiae LMG 24235

Annotation: transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR01461: transcription elongation factor GreB" amino acids 29 to 183 (155 residues), 219.5 bits, see alignment E=9e-70 PF03449: GreA_GreB_N" amino acids 30 to 100 (71 residues), 82.5 bits, see alignment E=2e-27 PF01272: GreA_GreB" amino acids 108 to 181 (74 residues), 80.2 bits, see alignment E=8.8e-27

Best Hits

Swiss-Prot: 61% identical to GREB_NEIMB: Transcription elongation factor GreB (greB) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 97% identity to bph:Bphy_0673)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>QEN71_RS03685 transcription elongation factor GreB (Paraburkholderia sabiae LMG 24235)
MNKAFVKESTDENDDDLEAAQPDVPAGAKNYITPAGYRRLRDELLHLIDEARPEVVKLVS
WAASNGDRSENGDYIYGKRRLREIDRRIRFLTKRIDLAEVVNSSRQENTDQVFFGATVEY
ATEDGETHTVKIVGIDEVNLDEGHVSWISPIARALLKSKVGDQVTLHTPAGPQPIDVLDV
VYPTREEEEA