Protein Info for QEN71_RS03410 in Paraburkholderia sabiae LMG 24235

Annotation: putative hydroxymethylpyrimidine transporter CytX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 19 to 402 (384 residues), 134.5 bits, see alignment E=2.5e-43 TIGR02358: putative hydroxymethylpyrimidine transporter CytX" amino acids 31 to 427 (397 residues), 381.9 bits, see alignment E=1.9e-118

Best Hits

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_0640)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>QEN71_RS03410 putative hydroxymethylpyrimidine transporter CytX (Paraburkholderia sabiae LMG 24235)
MAQDPIAGETGSTYAPLKPVPDARRAFKTGDAFALWFSLGIGLLVAQAGALLVPGLSLPH
ALLAILIGSVIGVVLLALAGVIGTDTGLAAMSSLRPTLGVRGASIPAVLNMVQLVGWGSF
EVIVMRDSADALSKQAFGFSAPLLWTLIFGVLATLLAISGPLSFVRRFLRTWGIWLLLAG
AGWLTYAVLAKQNLGELMHRPGNGEMSFGGAIDLVVAMPLSWLPLIADYTRFGRKAGETF
RGTILGYGIANIWFYALGAVYGLAAGGGDALLTTALAQAGGGLALLLVLIDEIDNAFADV
HSAAVSTGTFWTRASVPLLSAAFGALCTLIALAVPMAKYQNFLLLIGSVFAPLFGVVLVD
HFIVRKRRIEVDALADTQGRYGYSGGWHMSAFIAWAIGIAAYQAINQWLPNLGATLPALV
IGAVCYLAFVSARKQAYA