Protein Info for QEN71_RS03345 in Paraburkholderia sabiae LMG 24235

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 186 to 212 (27 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 272 (178 residues), 51.6 bits, see alignment E=5e-18

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to bph:Bphy_0630)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>QEN71_RS03345 carbohydrate ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MQPKMNFSRAVIYAALILFALYFLFPLYVMLSTSFKDIDQLRTGNLLTPPTHWTFAPWVK
AWSQACTGVRCDGMEPFFMNSVKMVIPAVLISSIIGAFNGYVLTHWRFRGADALFTMLLV
GCFIPFQAILLPMARLQGFFGLSNTIGGLVLVHVVYGIAFTTMFFRNFYVSVPAELVKAA
RIDGAGFFMIFTKIMMPISLPIFMVCLIWQFTQIWNDFLFGIVFSGVDSMPITVALNNLV
NTSTGVKEYNVDMAGAIIAALPTLLVYVIAGRYFVRGLTAGAVKG