Protein Info for QEN71_RS03340 in Paraburkholderia sabiae LMG 24235

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 277 (196 residues), 48.3 bits, see alignment E=5.1e-17

Best Hits

Swiss-Prot: 37% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to bph:Bphy_0629)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>QEN71_RS03340 sugar ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MAALADRWMPKLVLSPSIVISLVFVYGFILITGYLSLSTSRLMPRYDFAGFDRYAELFDN
DVWWTSAANLGWFGIPFIAICIGLGLFLAILLDQKIRNEGALRAVFLYPMALSFIVTGTA
WQWILNPDLGFQKVLNDWGWTSFSFGWLGDPDKAIFCVVIAAVWQSTGFVMALFLAGLRG
VDSEIFKAAQVDGATLPTIYRKIVIPSMRPVFFSVLLILCHITIKTFDLVVALTAGGPGT
SSSLPAMFMYTFSFNRGQLGVGAASSMMMLATVVAVLVPLMYLESRSTRNAA