Protein Info for QEN71_RS02935 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 51 to 73 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 151 to 194 (44 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details PF12911: OppC_N" amino acids 40 to 89 (50 residues), 28.5 bits, see alignment 1.1e-10 PF00528: BPD_transp_1" amino acids 130 to 310 (181 residues), 87.9 bits, see alignment E=7.1e-29

Best Hits

Swiss-Prot: 39% identical to DPPC_ECOL6: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 95% identity to bph:Bphy_0556)

MetaCyc: 39% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>QEN71_RS02935 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTTTPSTPNTPNTPNTPNTPDTPDKPVPPSTPRARDSRHDVLRALLRSPTFIVGALIVL
WWIVCAIAGLWIAPLDPYASDPLNSLTPPAQGHWFGTDQLGRDVLSRVIVGARDILTIAP
LATLLGTLAGTALGLFVGYFDGWVDNVVGRAIDAVLALPLVIVALLALAAVGASNFTVIL
VIGITFTPITARTVRAAVFAERHLDYVAAAQLRGENAFYIMFAEILPNVLPPIIVEATVR
LGYAIFAVATLSFLGFGIQPPSADWGLALSESYTLMAGGAWWTVVFDAAAIASLVVGVNL
IADAVQGAVDA