Protein Info for QEN71_RS02450 in Paraburkholderia sabiae LMG 24235

Annotation: 5-(carboxyamino)imidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 17 to 385 (369 residues), 376.7 bits, see alignment E=6.7e-117 PF02222: ATP-grasp" amino acids 122 to 294 (173 residues), 158.7 bits, see alignment E=1.1e-50 PF17769: PurK_C" amino acids 320 to 387 (68 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 97% identity to bph:Bphy_0464)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>QEN71_RS02450 5-(carboxyamino)imidazole ribonucleotide synthase (Paraburkholderia sabiae LMG 24235)
MNPDNTPVSPIMPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDPDETSPAGAVADRHLR
AAYDDEAALTELARLCAAVSTEFENVPAASLDFLARTTFVSPAGRCVAVAQDRIAEKRFI
ASSGVPVAPHVVIETSDALAAIDDAALEAVLPGILKTARMGYDGKGQVRVNTVAEVRAAY
ASLGGVPTVLEKRLPLKFEVSALIARGATGCSAVYPLAQNTHRNGVLSHTIVPAPDANAT
LVEQAQQAALQIADKLGYVGVLCVEFFILEDGTLVANEMAPRPHNSGHYTVDACATSQFE
QQVRAMTGMPLGDTRQHSPAVMLNILGDVWFPANAKGDKPTAAVTPPWHEVAAMPEARLH
LYGKEEARPGRKMGHVNFTAATLEHARSAARDCARLLHIPTN