Protein Info for QEN71_RS02445 in Paraburkholderia sabiae LMG 24235

Annotation: 5-(carboxyamino)imidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF00731: AIRC" amino acids 12 to 159 (148 residues), 207.5 bits, see alignment E=3.5e-66 TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit" amino acids 12 to 160 (149 residues), 204.6 bits, see alignment E=3e-65

Best Hits

Swiss-Prot: 69% identical to PURE_BACSU: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 98% identity to bph:Bphy_0463)

MetaCyc: 58% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>QEN71_RS02445 5-(carboxyamino)imidazole ribonucleotide mutase (Paraburkholderia sabiae LMG 24235)
MSEAHTHSAPVIGVLMGSSSDWEVMKNAVAILQEFGVPYEAKVVSAHRMPDEMFAYAESA
RERGIRAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASKYLKGVDSLHSIVQMPKGVPVAT
FAIGEAGAANAALFAVSLLSGTSPEYAEKLAAFRVRQNEAAHAMTLPPL