Protein Info for QEN71_RS02440 in Paraburkholderia sabiae LMG 24235

Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 15 to 294 (280 residues), 276.1 bits, E=1.7e-86
• PF01259: SAICAR_synt
  • amino acids 15 to 267 (253 residues), 258.8 bits, E=2.8e-81

Best Hits

Swiss-Prot: 80% identical to PUR7_CUPTR: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 98% identity to bph:Bphy_0462)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (296 amino acids)

>QEN71_RS02440 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Paraburkholderia sabiae LMG 24235)
MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPDKGRVLNQM
ANFWFDKLSHVVPNHLTGVAPESVVAADEAEQVKGRAVVVKRLEPILVEAVVRGYLAGSG
WKDYQATGAVCGVQLPEGLQNAQKLPEPIFTPAAKAEMGHHDENITYDEMERRIGTELSA
TIRDISIRLYKEAAEYAATRGIIIADTKFEFGLDEHGKLYLMDEALTADSSRFWPADQYQ
VGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDEVVTKTAEKYQEALERLTGQKLD