Protein Info for QEN71_RS02430 in Paraburkholderia sabiae LMG 24235

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 3 to 327 (325 residues), 367.6 bits, E=5.7e-114
• TIGR01064: pyruvate kinase
  • amino acids 3 to 474 (472 residues), 511.4 bits, E=1e-157
• PF02887: PK_C
  • amino acids 360 to 472 (113 residues), 109.6 bits, E=9.8e-36

Best Hits

Swiss-Prot: 51% identical to KPYK2_SALTY: Pyruvate kinase II (pykA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 99% identity to bph:Bphy_0460)

MetaCyc: 51% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• Bifidobacterium shunt (15/15 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• heterolactic fermentation (16/18 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (478 amino acids)

>QEN71_RS02430 pyruvate kinase (Paraburkholderia sabiae LMG 24235)
MHRATKIVATIGPASSTQDILLQMIQAGADVVRLNFSHGTADDHRQRADFVREAARQAGR
EVGIMADLQGPKIRVGKFENGKTTLIAGNTFILDADCELGNDDRVGLDYKDLPRDLRAGD
TLLLNDGLIVLTVSRVIGNEIHTVVKIGGDLSNNKGINRQGGGLTAPALTAKDMEDIRTA
MSLGADYVAVSFPKNATDMEMARQLANIAGAPYGIKPKMIAKIERAEAIPALQGILEASD
GIMVARGDLAVEVGNAAVPALQKRMIKMARDMNKFVITATQMMESMIHAPVPTRAEVSDV
ANAVLDGTDAVMLSAESAAGKYPVQTIETMAAICIEAEKSEHVELDKDFLDRTFTRIDQS
IAMGALFTAYHLGAKAIVALTESGSTALWMSRHWTHVPIFALTPRTGSERAMAIYRNVTS
LHLDTSSDRDIALAQALEVVVGKGYAARGDMVVLTVGEPMGQAGGTNTLKIVRVGEPV