Protein Info for QEN71_RS02380 in Paraburkholderia sabiae LMG 24235

Annotation: M48 family metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01435: Peptidase_M48" amino acids 128 to 316 (189 residues), 111 bits, see alignment E=3.2e-36

Best Hits

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_0450)

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>QEN71_RS02380 M48 family metalloprotease (Paraburkholderia sabiae LMG 24235)
MRLKRILAALLSVTLAVPPAIVAQPSNLSELPLVTGPLDTYGSASVPPDIAQGVFGVYGG
AQSRFSGNPGGNASLRAPMSTQQLPDLGDGSGGSLTPQAERKLGERVMREVRSDPDYIDD
WLVRDYLNSISARLAAAATAQYIGGYRPDFDLFAMRDAQINAFSLPGGFIGVNTGLIVAT
QTESELASVVGHEMGHVLQRHIARMITAGEHSGYAALAGMLLGVLAGVLAHSGDLGSAIA
VGGQAYAVDNQLRFSRAAEHEADRVGFQMLAAAGYDPYGMVAFFERLDRASMSDAGAPAY
ARTHPLTGERIADMADRARRSPYRQPRQSSEYAFVRARARVLQDRSRSEYADDISRMRSE
IEDRTALNVAANWYGIAYAQMLIDRYDDAATSLANARAAFDANERAEGDSTRSSPSLDVL
AVDLARRSGRNDEAVRLAEIAQKRWPQSHAAIDMRLQTLLTARRFNEAQAQALRETRADP
QQPVWWRYLAQASVGTGDALTQHRALAEKFALEGAWPSAIRQLKEARDIKSVGYYDLATI
DARLHEFEARYKEEREDEKNSS