Protein Info for QEN71_RS02090 in Paraburkholderia sabiae LMG 24235

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1040 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 183 to 204 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 223 to 347 (125 residues), 44.9 bits, see alignment E=1.2e-15 amino acids 350 to 474 (125 residues), 23 bits, see alignment E=6.9e-09 amino acids 499 to 600 (102 residues), 61.1 bits, see alignment E=1.1e-20 PF13188: PAS_8" amino acids 225 to 271 (47 residues), 27.7 bits, see alignment (E = 6.5e-10) amino acids 479 to 532 (54 residues), 24.3 bits, see alignment 7.9e-09 PF13426: PAS_9" amino acids 238 to 340 (103 residues), 11.4 bits, see alignment E=0.00011 amino acids 488 to 592 (105 residues), 72.7 bits, see alignment E=9.2e-24 PF08448: PAS_4" amino acids 360 to 470 (111 residues), 58.8 bits, see alignment E=2.1e-19 amino acids 501 to 593 (93 residues), 35.9 bits, see alignment E=2.8e-12 PF00989: PAS" amino acids 499 to 590 (92 residues), 39.4 bits, see alignment E=1.9e-13 PF08447: PAS_3" amino acids 502 to 586 (85 residues), 36 bits, see alignment E=2.4e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 600 to 763 (164 residues), 151.1 bits, see alignment E=2.3e-48 PF00990: GGDEF" amino acids 604 to 760 (157 residues), 163.1 bits, see alignment E=1.7e-51 PF00563: EAL" amino acids 781 to 1016 (236 residues), 274.7 bits, see alignment E=2.1e-85

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_0391)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1040 amino acids)

>QEN71_RS02090 EAL domain-containing protein (Paraburkholderia sabiae LMG 24235)
MISFLSKRLLINLAVVAAAVGANAFVAYTQICGQRDADARTARSTAIRQNLEAYRSTLED
GLGVLGRYEASAEPAPEKAVANMTASLAQIDRALHEQLAGQPRVAGALDDLTVNGKRLQQ
DIAVALAKTTAPEQDGSRAWAAQTYTRLGMEVDRLEAHMDQLRAEEDRALKDALEASTRD
SRYAMLFLVVTMLAGGGLLIYTFGARENVAREKLRIARALHRNDERFRGLFEQHPVPMYI
FDRDTLRFLAVNTAAVQQYGYSESEFLAMTVRAIRPHSEVTRLETHLQRSDVTPGGPRTM
AGVWHHRRKDGSQISADISYHAMTFMGRPALFVLADDVTEQINAEAEAQRSNQMLETVID
NIPQRIFWKDKELRYLGCNMAFARDAGLAYPEQVIGKRDEDMPWRGFAEGLARQDTEVMA
SGVPKMNYETDIVIDGVHRTTVTSKLPFTDSDGRVIGVLGSYTDITERKRADLALRLQSR
ALDASVNAILITGPSKEGNLIEYVNPAFKRITGYDPQEVIGQDCRLLQRNDRDQEGIAAI
RQALAANREVSAVLRNYRKDGALFWNQLYIAPVPDADGQTTHHIAVINDVTALIRYQEQL
EYQANYDSLTRLPNRNLLRDRLQHALIVAQRHHKGVAVVFIDLDGFKNVNDSLGHSVGDR
LLSVVADRLARAARASDTVARHGGDEFVIVMTDTVDEQSLIAWMERVRASISEPVWLDGT
ELYVGCSMGASLFPQDGDDAETLMKKADLAMYRAKDMGRNTFQFYQPEMNVSAGARLNLE
RRLRRALRDNEFLLHYQPQVDIETGQVVGMEALVRWHDPEVGLIPPSQFIPVAEESGLIG
PLSEWVLREACRQNKAWQDEGLPPARVSVNLSARQFQQRDIAKLVMQVLEETGLDPQYLE
LELTESTIMRNAEEAVSMLNELHALGIGLAIDDFGTGYSSLSYLKRFPVDRLKIDRSFVS
DIGESSDDETITSAIIALAHSLNLQVIAEGVETSTQLDFLKERACDEMQGYYFAKPLPHH
AIPGMLQRGAESAAIATADA