Protein Info for QEN71_RS01575 in Paraburkholderia sabiae LMG 24235

Annotation: bifunctional helix-turn-helix transcriptional regulator/GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF12802: MarR_2" amino acids 36 to 92 (57 residues), 33.8 bits, see alignment E=9.1e-12 PF01047: MarR" amino acids 36 to 92 (57 residues), 38.6 bits, see alignment E=2.4e-13 PF13463: HTH_27" amino acids 39 to 101 (63 residues), 26.8 bits, see alignment E=1.6e-09 PF13673: Acetyltransf_10" amino acids 191 to 286 (96 residues), 44.2 bits, see alignment E=5.7e-15 PF00583: Acetyltransf_1" amino acids 193 to 283 (91 residues), 55.2 bits, see alignment E=2.5e-18 PF13508: Acetyltransf_7" amino acids 201 to 283 (83 residues), 53.9 bits, see alignment E=5.8e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_0291)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>QEN71_RS01575 bifunctional helix-turn-helix transcriptional regulator/GNAT family N-acetyltransferase (Paraburkholderia sabiae LMG 24235)
MNDPDIARAEQVRHFNRFYTQHIGALHEHLQKSPFSLTEVRVMHELSRSQHQTAAALARD
LGIDSGYLSRLLASFERRNLISRKPSEIDARQSLVSLTETGLAAYRPLDAAAIDEVVAVL
ARLAPHSQDQLIAAMKLIERLLDERPRHSIVTLRAPRAGEYGLLVSRQAQLFAQAHGWDH
TFEALLAQQAARFAQGHDVQRENCWVAEQDGLIVGSALVTSAADAQANVHMLYVEPDVRR
LGIGTQLINECVRFAKRAGYRTLSVEGESSLDEARRLFTQAGFALLAAAPERRFGRDLVI
ERWERGM