Protein Info for QEN71_RS01205 in Paraburkholderia sabiae LMG 24235

Annotation: 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 16 to 259 (244 residues), 261.6 bits, E=3.4e-82
• PF00561: Abhydrolase_1
  • amino acids 21 to 245 (225 residues), 100.8 bits, E=2e-32
• PF12697: Abhydrolase_6
  • amino acids 26 to 250 (225 residues), 62.8 bits, E=1.5e-20
• PF12146: Hydrolase_4
  • amino acids 26 to 235 (210 residues), 53.1 bits, E=5.6e-18
• PF03096: Ndr
  • amino acids 45 to 257 (213 residues), 32.4 bits, E=8.5e-12

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 92% identity to bph:Bphy_0193)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (10/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (262 amino acids)

>QEN71_RS01205 3-oxoadipate enol-lactonase (Paraburkholderia sabiae LMG 24235)
MQINVNGIDTRYILSNEGGGPWLTFIHQLGGDLSIWDQLAGYFRDDFTVLRYDVRGHGQT
AASDRQFSVADLSQDLRALLDALGVQKTHIVGMSMGGMIAQQFALDDPARIETLTLTDTH
AASPADGRAVWEQRAAKARDEGVAALAQATIERWLTAGFRDAHPEVVEQIREVFENTSSE
GYAQACFALRDFDVRSRLKEIALPTLAVAGRHDAGTPPAATQEIANAIRDAQFELLDAAH
LAPIEQSQRFTALLESFLQKRV