Protein Info for QEN71_RS00320 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 136 (61 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details PF02518: HATPase_c" amino acids 308 to 414 (107 residues), 52.9 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 97% identity to bph:Bphy_0067)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>QEN71_RS00320 ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MHRITITGRVNLGHLFWLRSLAIIGQLVTIAFVQTFVGVKLPLPAMLLVIGLEVIFNGLT
WLRVASQKPESNLELFGQLWVDLGALSALLFLSGGTTNPFVSLYLPSLAIAAAVLPWHLM
AWLAAFAVACYAVLGFESVPLNLDNPANLFDYYRAGMWVNFMVSVGLIAWFVARMSRALR
QRDTALGEAQQRLLRDERAVALGVQAATVAHEIGTPLSTIAMLTEELRDAARSDGGLKPY
AADLDILDQQMTLCTSALARLRSRASTQGSRQRVDEWLDSFADQWRLRHPHVKFERLGEP
PANVGIDDTVAVSQILTILLDNAARASRDHVTLAAKLVEPASIEFEVCDAGPGVPAALRG
LLGAAPVDSTQGGHGVGLYLAFSAAARLGGSIELTDVSEIKPRGTRAVLRLPLAREQTGA
GRQGAASSNTEKQA