Protein Info for QEN71_RS00115 in Paraburkholderia sabiae LMG 24235

Annotation: PaaI family thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 52 to 73 (22 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 18 to 131 (114 residues), 54.6 bits, see alignment E=5.5e-19 PF13622: 4HBT_3" amino acids 47 to 130 (84 residues), 39.5 bits, see alignment E=8.3e-14 PF03061: 4HBT" amino acids 48 to 121 (74 residues), 55.9 bits, see alignment E=6.9e-19 PF20789: 4HBT_3C" amino acids 53 to 123 (71 residues), 24.2 bits, see alignment E=5e-09

Best Hits

KEGG orthology group: None (inferred from 98% identity to bph:Bphy_0027)

Predicted SEED Role

"FIG00454661: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>QEN71_RS00115 PaaI family thioesterase (Paraburkholderia sabiae LMG 24235)
MDDNEVRELLDRVLAPWVRALSLTPVKVDDESATLRLPFSGELRHSGGVICGQVFMAAAD
TAMVVAISAALGGFKPMTTVSLNISFMRAVRKGDVQITARVLRMGRNLVFGEVELIDEDG
KMAVHATITYALLN