Protein Info for Psyr_4875 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 69 to 91 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 248 (168 residues), 111.2 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 78% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to psb:Psyr_4875)

MetaCyc: 78% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZLS0 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Psyr_4875 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSLSASQRIVHRLAPWALPVLLLAVWQLSVSAGWLSTRILPAPSAVIEAGINLVASGEIW
THLAISGWRAGIGFAIGGGIGLALGFITGLSKWGERLLDSSVQMIRNVPHLALIPLVILW
FGIDETAKIFLVALGTLFPIYLNTYHGIRNIDPALVEMSRSYGLSGFSLFRHVILPGAMP
SILVGVRFALGFMWLTLIVAETISASSGIGYLAMNAREFLQTDVVVLAIVLYAVLGKLAD
LAARGLERVCLRWHPAYQTSKGGAA