Protein Info for Psyr_4781 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding:Protein of unknown function DUF224

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details PF11982: DUF3483" amino acids 5 to 221 (217 residues), 293.2 bits, see alignment E=4.8e-91 PF13237: Fer4_10" amino acids 244 to 336 (93 residues), 38.4 bits, see alignment E=3.5e-13 PF13183: Fer4_8" amino acids 244 to 338 (95 residues), 36 bits, see alignment E=2.9e-12 PF13187: Fer4_9" amino acids 245 to 337 (93 residues), 30.6 bits, see alignment E=1e-10 PF02754: CCG" amino acids 405 to 483 (79 residues), 19.7 bits, see alignment E=2.7e-07 amino acids 527 to 613 (87 residues), 53.7 bits, see alignment E=6.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4781)

Predicted SEED Role

"DgcB Dimethylglycine demethylase subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZM14 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Psyr_4781 4Fe-4S ferredoxin, iron-sulfur binding:Protein of unknown function DUF224 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MMLDTLLPILLFSALALAALGAWRRVTLWRNGRSSKVDWLGGLLAMPKRYMVDLHHVVAR
DKYIANTHVATAGGAVASIVLAILVHGFGLHNRVLGYALLLMTAVMFVGAVFVYRRRLNP
PARLSKGPWMRLPKSLMAFSASFFLVTLPVAGILPEHFGGWVLVAVLGLGVLWGVSELFF
GMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLDLADRSAPLGVEKPQDFTWNQL
LGFDACVQCGKCEAACPAFAAGQPLNPKKLIQDMVVGLAGGTDAKFAGSPYPSLDGKGKP
LGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIEHVDAIVDMRRHLTLEKGATP
NKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLTLLSEKKTVDVLFWVGDGAFDMRNQRT
LRAFVKVLKAAGVDFAVLGLEERDSGDVARRLGDEATFQTLARRNIQTLSRYSVQRIVTC
DPHSFHVLKNEYGAFGGDYQVQHHSTFMAELVRSGALNLSQHKGASVTYHDPCYLGRYNG
EYEAPREVLRALGIEIREMQRSGFRSRCCGGGGGAPITDIPGRQRIPDMRMDDIRETAAE
LVAVGCPQCTAMLEGVVEPRPLIKDIAELVADALIEEVIPSTPAPAKREPAEVH