Protein Info for Psyr_4298 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF00892: EamA" amino acids 15 to 142 (128 residues), 70.4 bits, see alignment E=8.6e-24 amino acids 153 to 286 (134 residues), 62.8 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 55% identical to YEDA_ECO57: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4298)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNE4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Psyr_4298 Protein of unknown function DUF6 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPQSVRVSPLLIGAFLALYLIWGSTYLVIRIGVESWPPLMMAGVRFLIAGCLMYGFLRFR
GVPAPTWREWKAAFVIGFLLLACGNGGVTLAEHAGVASGVAALAVATMPLFTLLFGLFWG
NRTTNLEWAGIVLGLIGIGLLNLGSNLQASPYGAAVVIFAAAAWAFGSVLSKHLPLPKGP
MASAAEMITAGATLLIGSALSGERLAHMPTAAGWGALLYLVVFGSIVAFSAYMYLLKNVR
PAAATSYAYVNPAVAVMLGVVFAGETIGVEECMAMVVIISAVVLIGLPQWRRSPPPEVAS
TRTS