Protein Info for Psyr_4115 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF13580: SIS_2" amino acids 15 to 146 (132 residues), 116.5 bits, see alignment E=9.3e-38 PF01380: SIS" amino acids 88 to 154 (67 residues), 28.7 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 100% identical to GMHA_PSEU2: Phosphoheptose isomerase (gmhA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to psb:Psyr_4115)

MetaCyc: 45% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNX7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Psyr_4115 phosphoheptose isomerase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDMQSRIRRLFQASIETKQQAMEVLAPFIEQASQVMVNALLNEGKMLACGNGGSAGDAQH
FSSELLNRFERERPSLPAIALTTDSSTITSIANDYSYNEIFSKQIRALGQPGDVLLAIST
SGNSANIIQAIQAAHDREMIVVALTGRDGGGMASLLLPEDVEIRVPANVTARIQEVHLLA
IHCLCDLIDSQLFGSEE