Protein Info for Psyr_4106 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 26 to 94 (69 residues), 36.1 bits, E=1e-12
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 30 to 448 (419 residues), 452.5 bits, E=7.5e-140
• PF08245: Mur_ligase_M
  • amino acids 108 to 296 (189 residues), 159.1 bits, E=2.2e-50
• PF02875: Mur_ligase_C
  • amino acids 318 to 384 (67 residues), 33.7 bits, E=5.6e-12

Best Hits

Swiss-Prot: 43% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to psb:Psyr_4106)

MetaCyc: 43% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See Q4ZNY6 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Psyr_4106 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLKPMTFRELVVPLDARLVGGDCSFAGVSTDSRGIEPGQLFVALTGPRFDGHEYLDQVAA
KGAVGALVEREVQGAALPQLVVLDTRKALAQLGAMNRNAFVDRPVAAVTGSSGKTTVKEM
LASILRTRGPVLATRGNLNNELGVPLTLLELAPEYTSAVIELGASRVGEIAYTVSLAKPH
VAMITNAGTAHVGEFGGPDRIVEAKGEILEGLDAGGTAVLNLEDKAFPIWRKRAGNRNIL
TFALTDSAADVYASELSRDARGCPAFNLNSPLGTARVQLNLLGTHNVSNALAAAAAGCAM
GVPLEGIVTGLNNVQPVKGRAVAQIASNGTRVIDDTYNANPASINAAVDILTGFTGRTVL
VLGDIGELGDWAEQGHREVGAYAAGKVSALYAVGPLMTHAVSAFGEHAYHFASQAELIAA
LGAEQDPDTTLLIKGSRSAAMEHVVAALCGSSLEKH