Protein Info for Psyr_4100 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR01205: D-alanine--D-alanine ligase" amino acids 20 to 313 (294 residues), 351.1 bits, see alignment E=2.4e-109 PF01820: Dala_Dala_lig_N" amino acids 68 to 102 (35 residues), 44 bits, see alignment 7.7e-15 PF02786: CPSase_L_D2" amino acids 115 to 195 (81 residues), 23.1 bits, see alignment E=1.2e-08 PF02222: ATP-grasp" amino acids 119 to 268 (150 residues), 32.5 bits, see alignment E=1.7e-11 PF07478: Dala_Dala_lig_C" amino acids 120 to 311 (192 residues), 189.2 bits, see alignment E=1.6e-59 PF13535: ATP-grasp_4" amino acids 147 to 282 (136 residues), 29.7 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 96% identical to DDLB_PSESM: D-alanine--D-alanine ligase B (ddlB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to psb:Psyr_4100)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNZ2 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psyr_4100 D-alanine--D-alanine ligase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTAVAQSSLRSTLEPKSFGRVAVLFGGKSAERAVSLNSGNAVLGALLEAGVDAFGIDVGD
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLATPAHAVLENESDCICAATELGLPLIVKPAHEGSSIGMAKVNSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLGD
AQEQELKQLAARACDAIGIAGWARTDVMQDAQGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVQARG