Protein Info for Psyr_4064 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: lipoprotein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF09375: Peptidase_M75" amino acids 37 to 332 (296 residues), 201 bits, see alignment E=1.6e-63

Best Hits

KEGG orthology group: K07338, hypothetical protein (inferred from 100% identity to psb:Psyr_4064)

Predicted SEED Role

"Iron-regulated protein A precursor" in subsystem Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP28 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psyr_4064 lipoprotein, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MFRPKLLLTSLAALALGACSPSDPQAVTSAAIAKQVILPTYSRWVEADRQLAASALAFCQ
GKTDLASARADFLKAQKTWAELQPLLIGPLAEGNRAWQIQFWPDKKNLVGRQVEQLVTAQ
PQITAQELSKASVVVQGLSAYEYILFDADIDMANAEQKARYCPLLMAIGERQKQLAEEIL
NSWNSTDGMLAQLSKFPNQRYADSHEAIAELLRVQVTALDSLKKKLGTPLGRQSKGQPQP
FQADAWRSKSSLSSLEASLISAETVWTGVDNKGLRSLLPAEQKPLADKIDAAYANSRKLL
SELKPPLADLLATDAGRQQLNAFYDSLNAVHRLHEGELAKALGIQLGFNANDGD