Protein Info for Psyr_4022 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 104 to 126 (23 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details PF01944: SpoIIM" amino acids 110 to 290 (181 residues), 126.9 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4022)

Predicted SEED Role

"FIG01248689: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP70 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Psyr_4022 integral membrane protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKQSLFETRHQQEWQRFEQRLTALEQGKGDVSGGATFPGDYRRLCHHLALAQERGYSSHL
VDPLHQLAMRGHQQLYRHRSTAGVRLLSFVLADFPRRVRAEWRFVLVASLLLFGSLIGMA
LLVYGFPQLIYSVVSPEQLADMQSMYDPSASRVGQPVERGSDTDWMMFGYYIMNNIGIAF
QTYASGLLFGLGSLFFLLFNGLMTGAIAGHLTDIGYGQTFWPFVIGHGAFELTAIALAGA
AGLKLGWALLAPGRLTRSAALRIAARASMQLVGGVILFLLIAAFIEAYWSSMTWPGPLLK
YLTGAVLWLLVAAYLTLAGRTPHAPD