Protein Info for Psyr_3969 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Putative ammonia monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 232 to 246 (15 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 9 to 164 (156 residues), 118.4 bits, see alignment E=1.2e-38 amino acids 182 to 337 (156 residues), 140.3 bits, see alignment E=2.3e-45 PF05145: AbrB" amino acids 32 to 338 (307 residues), 283.2 bits, see alignment E=1.2e-88

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 100% identity to psb:Psyr_3969)

Predicted SEED Role

"Ammonia monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPC3 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Psyr_3969 Putative ammonia monooxygenase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MADSSLRQWWATPLIGLLGGYLASQVGWPLPWMVGSLLAIILVRCLTPWQLAQIPGGRKC
GQLIIGIGIGLHFTPVVIEQVLAHFGLIFIGALVTSLSCLVGVWLMLRTGEDRPTAFFSS
MPGGSGEMVNLGARNGATLSSVAAAQSLRVLAVVLCVPAIFKYLLGDGAPALHASVVDWR
WLAVLLPLGAALAWLWQHLKQPNPWLFGPLLLSAVVSVVWDLKIGLPNGASQLGQLLIGS
GLGCHFNREFFRRAPSFLARTLLGTALTMLIAALAALALSALTHLDLRSLTLGMMPGGIA
EMSLTAEVLQLSVPLVTAMQVMRLLFVLFLAEPLYRRWNKRLAD