Protein Info for Psyr_3656 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ABC transporter, transmembrane region:ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 75 to 325 (251 residues), 101.1 bits, see alignment E=9.2e-33 PF00005: ABC_tran" amino acids 387 to 535 (149 residues), 104 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to psb:Psyr_3656)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ84 at UniProt or InterPro

Protein Sequence (608 amino acids)

>Psyr_3656 ABC transporter, transmembrane region:ABC transporter (Pseudomonas syringae pv. syringae B728a ΔmexB)
MHDEVPEAARQPHATRSDALSWAEIRRLALRHKKSLWLANGVAVLATLCSVPIPLLLPLL
VDEVLLGRGDAALKVMDHLLPGNWQKAAGYIGLMLSLTLVLRVGALVFNVLQARLFAGLA
KDIVYRIRLRLIERLKRISLREYESLGSGTVTTHLVTDLDTLDKFVGETLSRLLVATLTL
AGTAGILMWMHWKLALLIMLFNPLVILLTVKLGKRVKHLKKLENDSTSRFTQALSETLDA
IQEVRAGNRQGFFLGRLGVRAQEVRDYAINSQWKSDASGRASGLLFQFGIDIFRAAAMLT
VLFSDLSIGQMLAVFSYLWFMMTPVEQLLNLQYAYYAAGGALTRINELLARADEPQYAGG
TDPFEGKETVGVEVRGLTFGYGEDLVLDQLNLNIAPGEKVAIVGASGGGKSTLVQLLLGL
YTARTGVIRFGGVSQQDIGLETVRENVAVVLQHPALFNDTVRANLTMGRDCSDEACWRAL
EVAQLDSAIRDLPQGLDSVVGRSGVRMSGGQRQRMAIARMVLSDPKVVILDEATSALDAA
TEYNLHQALARFLRSRTTLIIAHRLSAVKQADRVLVFDGGRIAEDGDHQQLIADGGLYAK
LYGHLQQI