Protein Info for Psyr_3639 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Beta-lactamase-like:RNA-metabolising metallo-beta-lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF00753: Lactamase_B" amino acids 28 to 123 (96 residues), 35.3 bits, see alignment E=1.8e-12 PF10996: Beta-Casp" amino acids 245 to 395 (151 residues), 103.7 bits, see alignment E=1.4e-33 PF07521: RMMBL" amino acids 413 to 462 (50 residues), 38.7 bits, see alignment 1.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3639)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQA1 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Psyr_3639 Beta-lactamase-like:RNA-metabolising metallo-beta-lactamase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSYPQIIHHGAVDTVTGSCHQLHMNASSSLLIDCGSVQERGRRSGTASFGFDPEAIRALL
ISHVHNDHVGRIPELLASGYKGPILCSEPSAHLLPLVMEDLLKIEFAHDPGQVARYLDVI
NKRIIALPFNEWFSLVDNESLHCRVRLQRAGHILGSAYIECDLQYPAQGRSVRVVFSGDL
GASHTPFLPAPKPPERADVLVLESTYGNRIHEDRSIRQQGLERIIDKALEDNGTVLIPAF
SIGRTQELLYELEDILRHKMPLDHCAGNSEHLNDGDVPCADWSRLPIILDSPLASRFTRV
YQSFEDYWDEDARLRLDVGRKPLGFEQLVTVDTHEEHLRTVNYLASTARPAIVIAGNGMC
AGGRIVNYLKAMLGDTRHNVVFVGYQGKGTPGEAIQLHGPSGGYVELDRERFDIKAGVHT
AKGYSAHADQVELVEFVTGMKEWPTQIRLVHGEAVAKKVLGNILSRKYSLEKRPLELLIP