Protein Info for Psyr_3280 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: methylthioadenosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01694: methylthioadenosine phosphorylase
  • amino acids 4 to 243 (240 residues), 303.5 bits, E=4.6e-95
• PF01048: PNP_UDP_1
  • amino acids 4 to 243 (240 residues), 143.6 bits, E=3.3e-46

Best Hits

Swiss-Prot: 98% identical to MTIP_PSESM: Probable S-methyl-5'-thioinosine phosphorylase (PSPTO_3506) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 100% identity to psb:Psyr_3280)

MetaCyc: 80% identical to S-methyl-5'-thioinosine phosphorylase monomer (Pseudomonas aeruginosa PAO1)
RXN-12241 [EC: 2.4.2.44]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• L-methionine salvage cycle III (10/11 steps found)
• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• S-methyl-5'-thioadenosine degradation III (1/2 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28 or 2.4.2.44

Sequence Analysis Tools

See Q4ZRB0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Psyr_3280 methylthioadenosine phosphorylase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTVYAIIGGTGLTQLEGLNIRQSLPMNTPYGAPSGEIQIGDYAGREVMFLARHGHPHRLP
PHQVNYRANIWALKQAGAEAILAVNAVGGIHPAMGTGHFCVPHDLVDYTSGRQHTFFADD
LEEVTHIDFSYPYSEPLRARLIAALATEGCAFSDRGVYACTQGPRLETVAEIIRLERDGC
DIVGMTGMPEAALARELELEYACLALVVNPAAGKSTTVITMAEIEQALRDGMGKVKATLA
RVLSAS