Protein Info for Psyr_2767 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Glycoside hydrolase, family 19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF00182: Glyco_hydro_19" amino acids 41 to 137 (97 residues), 38.4 bits, see alignment E=6.1e-14

Best Hits

KEGG orthology group: K03791, putative chitinase (inferred from 100% identity to psb:Psyr_2767)

Predicted SEED Role

"FIG101079: Lytic enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSR6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Psyr_2767 Glycoside hydrolase, family 19 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPITAQQLLQILPNAGQKAGVFAPVLNTAMSKYQIVTPLRIAAFIAQVGHESGQLRYVRE
IWGPTPQQLGYEGRKDLGNTVPGDGSKYRGRGLIQITGRANYAECAEALGLDLINHPELL
ELAQHAAMSAAWFWHRAALNTLADKGDFLTITRRINGGTNGLADRQALYARALEVLA