Protein Info for Psyr_2467 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 3-methylcrotonoyl-CoA carboxylase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 PF00289: Biotin_carb_N" amino acids 7 to 114 (108 residues), 142.4 bits, see alignment E=2.6e-45 PF02786: CPSase_L_D2" amino acids 120 to 326 (207 residues), 264.7 bits, see alignment E=2e-82 PF02222: ATP-grasp" amino acids 128 to 296 (169 residues), 42.5 bits, see alignment E=2.1e-14 PF07478: Dala_Dala_lig_C" amino acids 142 to 295 (154 residues), 47.1 bits, see alignment E=7.5e-16 PF02785: Biotin_carb_C" amino acids 340 to 447 (108 residues), 125.9 bits, see alignment E=2.7e-40 PF21139: BT_MCC_alpha" amino acids 460 to 568 (109 residues), 43.7 bits, see alignment E=1.2e-14 PF00364: Biotin_lipoyl" amino acids 583 to 648 (66 residues), 57.7 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 100% identity to psb:Psyr_2467)

MetaCyc: 74% identical to methylcrotonyl-CoA carboxylase alpha-subunit (Pseudomonas aeruginosa PAO1)
Methylcrotonoyl-CoA carboxylase. [EC: 6.4.1.4]

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTL6 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Psyr_2467 3-methylcrotonoyl-CoA carboxylase, alpha subunit (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSMPELTTLLIANRGEIACRIMRTAKNMGLTTVAVHSAIDRDARHSREADLCVDLGGSKA
ADSYLAIDRLIEAARASGAHAIHPGYGFLSENADFARAVEDAGLIFLGPPASAIDAMGSK
SAAKALMEQAGVPLVPGYHGEAQDVETFRAAAERIGYPVLLKATAGGGGKGMKVVEHTGE
LAEALASAQREALSSFGDARMLVEKYVLTPRHVEIQVFADRHGNCLYLNERDCSIQRRHQ
KVVEEAPAPGLTASLRKAMGEAAVKAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVE
HPVTEYITGLDLVEWQIRVARGESLPITQEQVPLTGHAIEVRLYAEDPVNDFLPATGTLE
LYREPAPGPGRRVDSGVAEGDSISPFYDPMLGKLIAWGEDREQARLRLLAMLDEFAVGGV
RTNLAFLRRIIAHPAFAAAQLDTGFIPHHQAQLLPHTNEPDETFWQAAAEAFSQSEPARI
DQADPYSPWAVSSGFRAGLPAQTDLRLSCNGLTRNTCLRNSSPSLFTLSGEHLQVEHNGV
RQRHLAIRRGNTLYLEWQGEVQTVTRLDAIAQADVGEGQHAGLTAPMNGSIVRVLVEVGQ
AVEPGAQLVVLEAMKMEHSIRAASAGVITALYCHEGEMVNEGAVLVELD