Protein Info for Psyr_2367 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ABC-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 91 (40 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 180 to 218 (39 residues), see Phobius details amino acids 220 to 221 (2 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 272 (259 residues), 172.3 bits, see alignment E=7.5e-55

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 100% identity to psb:Psyr_2367)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTW6 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Psyr_2367 ABC-3 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MMLYSLVVEPFIEFGFMRRALVACLALGIGSGPVGVLLMLRRMSLVGDAMSHAVLPGAAV
GFMVAGLSLPAMGFGGLIAGLAVALLSGLVSRLTSLREDASFASFYLTSLAAGVLIVSLH
GSSVDLLHVLFGTILAIDDTAIYMVGSIASFTLILLAIIYRPLVLECFDPGFLRAVGGRG
SLYHVLFLLLVVLNLVAGFQALGTLMAVGMMMLPATAARFWTHSLSGLMVISTLLATLSG
LIGLIVSYHLGVASGPAIVLTASAFYGISLLFGRTGIVRRLFPKPHLAH