Protein Info for Psyr_2277 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 36 to 439 (404 residues), 434.5 bits, see alignment E=1.9e-134 PF00909: Ammonium_transp" amino acids 37 to 439 (403 residues), 374.8 bits, see alignment E=2.2e-116

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to psb:Psyr_2277)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU52 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Psyr_2277 ammonium transporter (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVNRLHGKSLTALLALGAFAPIAQAADAPVLNTGSTAWMVTAAVLVLFMCLPGLALFYGG
LVRAKNMLSLFTQCFGIAGVVGVLWVIYGYSMVVDTSNMVEGQVSFNSFVGGLSRAFLAG
MTPDSLVGDIPEGVFVTFQMTFAIITPALIAGAFAERMKFSAALLFMALWFTLVYAPVAH
MVWGGAGALMHNWGVLDFAGGTAVHINAGVAALAACLVLGKRKGYQNTPMPAHNLSLTMA
GAAMLWVGWFGFNIGSGGGLNGTSGIVMLNTQVGACAGILGWMFTEWFKVGKPSALGLAS
GALAGLVGITPACAYVGVGGALAIGVLCGVFCYLSVTVLKKRLGYDDSLDVFGLHGIGGM
IGAILTGVFCVPALGGLVPDVSMGAQVIAQIKGVLFTTAYCFAVSWIILKAVQALIGLRA
HESVEEMGLDLAEHNERAYNH