Protein Info for Psyr_2219 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00126: HTH_1" amino acids 29 to 84 (56 residues), 56 bits, see alignment E=3.2e-19 PF03466: LysR_substrate" amino acids 110 to 312 (203 residues), 143.8 bits, see alignment E=4.8e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2219)

Predicted SEED Role

"LysR-family transcriptional regulator clustered with PA0057" in subsystem PA0057 cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUB0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Psyr_2219 transcriptional regulator, LysR family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPQVKQKPQYWQLLIAYIGRIVDRIIAARVFIAINDRGSLIAAAEALDMSRAMVTRYLAQ
MESWAGARLLHRTTRKLGLTAPGQVTLLRCQQLVELADAVPLAADTQVDEPRGMLRIACS
QSLALAVLAPAVTAYLQRYPGTSADLLIGNEAVDLVSERIDLAIRITNQLDPNVIARPLG
QCASVVCAAPAYLAVHGTPSRPQELTAHNCLTYSYFGKSLWEFTRQQMPLSVPVGGNLSA
NDSVVLLEAAVAGAGISLQPVHSAAPLIASGKLIALMPEYQPRALGIHAIYTSRHHQSAT
LRTFLDFLTEWFERDGD