Protein Info for Psyr_2176 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 91.9 bits, see alignment E=7.2e-30 PF02770: Acyl-CoA_dh_M" amino acids 121 to 219 (99 residues), 76.3 bits, see alignment E=3.5e-25 PF00441: Acyl-CoA_dh_1" amino acids 232 to 366 (135 residues), 120.3 bits, see alignment E=1.7e-38 PF08028: Acyl-CoA_dh_2" amino acids 248 to 361 (114 residues), 52 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 100% identity to psb:Psyr_2176)

Predicted SEED Role

"Probable acyl-CoA dehydrogenase (EC 1.3.99.3)" in subsystem Isoleucine degradation or Valine degradation (EC 1.3.99.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUF3 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Psyr_2176 Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, N-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTDRNSEELNAIREGVRALCAEFDAAYWRKVDEEKGFPETFVKALTDAGWLAAMIPVEYG
GSGLGLAEASVILEEVNRCGGNSGTVHGQMYNMFTLLRHGSEAQKSYYLPKLASGELRLQ
SMGVTEPTTGTDTTKIKTTAVRKGDKYVINGQKVWISRVQHSDLMILLARTTPLTDVKKK
SEGMSIFLVDLREAIGNGMTVQPIANMVNHETNELFFDNLEIPADSLIGEEGKGFRYILD
GLNAERTLIAAECIGDGRWFIEKASAYARDRVVFGRPIGQNQGVQFPIAEAHIEIEAADL
MRWRACEEYDSGINAGASANMAKYLAAKASWEAANACLQTHGGFGFACEYDVERKFRETR
LYQVAPISTNLILSYVAEHLLELPRSF