Protein Info for Psyr_2006 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: succinate dehydrogenase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 10 to 120 (111 residues), 119.3 bits, see alignment E=3.9e-39 PF01127: Sdh_cyt" amino acids 10 to 83 (74 residues), 31.6 bits, see alignment E=8.2e-12

Best Hits

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 99% identity to pst:PSPTO_2196)

MetaCyc: 89% identical to succinate dehydrogenase hydrophobic membrane anchor subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUX3 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Psyr_2006 succinate dehydrogenase subunit D (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHGLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYFVWGVQILW
GI