Protein Info for Psyr_1763 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: RNase HI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00075: RNase_H" amino acids 4 to 141 (138 residues), 168.5 bits, see alignment E=5.1e-54

Best Hits

Swiss-Prot: 100% identical to RNH_PSEU2: Ribonuclease H (rnhA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03469, ribonuclease HI [EC: 3.1.26.4] (inferred from 100% identity to psb:Psyr_1763)

MetaCyc: 64% identical to ribonuclease HI (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HI (EC 3.1.26.4)" in subsystem Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVL1 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psyr_1763 RNase HI (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSDSVELFTDGACKGNPGPGGWGALLVCKGVEKELWGGEANTTNNRMELTGAIRGLEELK
RPCEVTLVTDSQYVMKGITEWMVNWKKRGWKTAAKEPVKNADLWQLLDEQVSRHTVKWQW
VRGHIGHPGNERADQLANRGVDEVRGIRHG