Protein Info for Psyr_1760 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Peptidoglycan-binding LysM:SLT:MLTD_N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF06474: MLTD_N" amino acids 1 to 34 (34 residues), 55 bits, see alignment (E = 1.5e-18) PF01464: SLT" amino acids 128 to 228 (101 residues), 91.8 bits, see alignment E=4.7e-30 PF01476: LysM" amino acids 349 to 391 (43 residues), 49.1 bits, see alignment 8.7e-17 amino acids 418 to 458 (41 residues), 47.5 bits, see alignment 2.7e-16 amino acids 489 to 530 (42 residues), 34 bits, see alignment 4.4e-12

Best Hits

KEGG orthology group: K08307, membrane-bound lytic murein transglycosylase D [EC: 3.2.1.-] (inferred from 100% identity to psb:Psyr_1760)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVL4 at UniProt or InterPro

Protein Sequence (534 amino acids)

>Psyr_1760 Peptidoglycan-binding LysM:SLT:MLTD_N (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSSSTSKPSHSDALTRLAQAMAVTASALLAGCQSTASVDPASNHRAPNLAAGIKQKPIFL
SHKPATPLAPPQDVWERMRQGFQLQQGNDQNPRIDQQRLWFANNPSFLENAGERGSLYMH
YIVERLEERNMPLELALLPVIESAYNPMAVSRSQAVGLWQFIPSTGRYFNLRQTSFYDGR
RDIQASTVAALDYLTRLHDMFNGDWLLALAAYNAGEGTVSRAIERNDKLNLPTDYWNLPL
PQETRDYVPKLLALSQVVLSPEAYGVNLNPIANQPYFEVVELNKRVDLSKVASAADIDED
ELIQLNPAYKKRLTVDGPQHLLVPTSKAQLLTASLLTMKQEELVAWQPYRVRKGDTLESL
ASRYQVTVSSLKGNNKLSGNRLKVGQSLSIPVKPGMQNSQPVFEALASNDKPSRTRSYKV
RSGDNLTNIAQANKVDVEDLQRWNKLTGKKLKVGQTLVMQDTSKPAGKAASKAVASTSAK
DGEKKSMQYKIQKGDSMYLVAKRFNVEMQHLKRWNPRSGQALKPGQTLTVYLPH