Protein Info for Psyr_1314 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: lipoprotein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF12146: Hydrolase_4" amino acids 64 to 170 (107 residues), 59.7 bits, see alignment E=1.1e-19 PF00561: Abhydrolase_1" amino acids 67 to 172 (106 residues), 52.2 bits, see alignment E=2.7e-17 PF12697: Abhydrolase_6" amino acids 68 to 269 (202 residues), 41.3 bits, see alignment E=1.2e-13 PF00326: Peptidase_S9" amino acids 87 to 240 (154 residues), 28.1 bits, see alignment E=5.7e-10 PF02129: Peptidase_S15" amino acids 87 to 174 (88 residues), 29.7 bits, see alignment E=2.2e-10 PF07859: Abhydrolase_3" amino acids 93 to 168 (76 residues), 25.6 bits, see alignment E=4e-09

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 100% identity to psb:Psyr_1314)

Predicted SEED Role

"Hydrolase of the alpha/beta superfamily in cluster with COG2110"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWV7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Psyr_1314 lipoprotein, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKLLGIFTLVLALTGCSSMLFYPEQGVPFTPDKARLQYQDVNLTAADGTRLHGWWLPAKE
GVPVKGTVLHLHGNGGNLSWHLGGVWWLPEQGYQVLMLDYRGYGESQGEPSLPAVYQDVQ
AAFDWLNTAPQVQGKPLVVLGQSIGGALAVHYLSEHPQERSRLKALVLDSVPASYRSVAR
NSLSKSWLTWPLKTPLSWLIPEADSAVNGLPRLAGTPMLIFHSMDDTLVPLANGIELYKA
APPPRVLQLTRGEHVQTFADPLWRQVMLRYLDDPTHFNGLRRLAEVPNYPTPATPPAQ