Protein Info for Psyr_1093 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: permease YjgP/YjgQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 351 (348 residues), 426.1 bits, see alignment E=3.8e-132 PF03739: LptF_LptG" amino acids 6 to 351 (346 residues), 277 bits, see alignment E=1.1e-86

Best Hits

Swiss-Prot: 38% identical to LPTG_HAEIN: Lipopolysaccharide export system permease protein LptG (lptG) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 100% identity to psb:Psyr_1093)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXH5 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Psyr_1093 permease YjgP/YjgQ (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVKLDRYIGKSVLLAILAVLGIILGLVSLFAFIDEMGDISDTYTLADALSYVMLTAPRRV
YDTLPMAALIGCLIGLGTLASSSELTIMRAAGVSIGRIVWAVMKPMLVLMIAGVLVGEYV
APYAENQAQAARSLAQGSGDAQSARHGLWHRQGDEFIHINTVQPNGLMLGVTRYRFDDQR
HMQTSSFAKEANFKTDYWELKDVTTTHFNDGRTEVINTPVERWDVALSPQLLSTVIMPPE
SLSISGLWSYAHYLADQGLSNGRYWLAFWTKVLQPAVTVALVLMAISFIFGPLRSVTLGQ
RVFTGVVVGFTFRIIQDLLGPSSLLFGFPPLLAVLLPAAACALAGVLLLRRAG