Protein Info for Psyr_0863 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: PhnA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 TIGR00686: putative alkylphosphonate utilization operon protein PhnA" amino acids 13 to 123 (111 residues), 164.2 bits, see alignment E=4.8e-53 PF08274: YjdM_Zn_Ribbon" amino acids 13 to 42 (30 residues), 62.7 bits, see alignment E=2.5e-21 PF03831: YjdM" amino acids 57 to 124 (68 residues), 111.9 bits, see alignment E=1e-36

Best Hits

Swiss-Prot: 70% identical to YJDM_ECOL6: Protein YjdM (yjdM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 100% identity to psb:Psyr_0863)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY51 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Psyr_0863 PhnA protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVLPLLDARTIVSLPSCPKCNSEYTYEDGSLLICPECAHEWSADAAGTDASDEVKVIKDS
TGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEF
VRKV