Protein Info for Psyr_0830 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Poly(A) polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 333 to 351 (19 residues), see Phobius details TIGR01942: poly(A) polymerase" amino acids 50 to 479 (430 residues), 625 bits, see alignment E=3.1e-192 PF01743: PolyA_pol" amino acids 81 to 214 (134 residues), 141.8 bits, see alignment E=2.2e-45 PF12627: PolyA_pol_RNAbd" amino acids 241 to 300 (60 residues), 70.2 bits, see alignment E=1.5e-23 PF12626: PolyA_pol_arg_C" amino acids 357 to 474 (118 residues), 142.2 bits, see alignment E=1.1e-45

Best Hits

Swiss-Prot: 45% identical to PCNB_HAEIN: Poly(A) polymerase I (pcnB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to psb:Psyr_0830)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY84 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Psyr_0830 Poly(A) polymerase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLESPPIMRSFHVFGRIFLQTVHPMLKKLFQSFRSPLRKPQQHTRTTPEVLNSSQHSLQR
SQFSRYAVNIVERLQNAGYQAYLVGGCVRDMMLNITPKDFDVATSATPEQVRAEFRNARI
IGRRFKLVHIHFGREIIEVATFRANHPQDDEEEDSNQSSRNESGRILRDNVYGTLEEDAQ
RRDFTINALYYDPVSERVLDYANGVHDIRNRLIRLIGDPEQRYKEDPVRMLRAVRFAAKL
DFGIEKHSAQPIRALAPMLRDIPSARLFEEVLKLFLSGHAAPTFEMLVDLELFEPLFPAS
SKALEYNPTYTHTLISNALINTDLRIKQNKPVTPAFLFAALLWPALPAKVLRAQERGMPP
IAAMQEAAHELIIEQCQRIAIPKRFTLPIREIWDMQERLPRRSGKRADLLLDNSRFRAGY
DFLLLRETAGEQTDGLGQWWTDYQDCNDSERRDMIRDLSNKPEAAGTAPRKRRRNSGAKR
KRTTGEAQSGE