Protein Info for Psyr_0795 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 9 to 183 (175 residues), 217.8 bits, E=4.8e-69
• TIGR00152: dephospho-CoA kinase
  • amino acids 10 to 192 (183 residues), 169.1 bits, E=4.7e-54

Best Hits

Swiss-Prot: 100% identical to COAE_PSEU2: Dephospho-CoA kinase (coaE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 100% identity to psb:Psyr_0795)

MetaCyc: 51% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See Q4ZYB9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Psyr_0795 dephospho-CoA kinase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTHPDEKPWILGLTGGIGSGKSAAAKCFSDLGIDTVDADHAARWVVEPGRPALEQIAAHF
GKGVLQTSGELDRGALRKLIFETPEQRRWLEALLHPLINQEIVSHLAKAKSPYAILVSPL
LVESGQYRMVQRLLVIDAPAHLQIERTMLRDSSSQEQVEAILKVQIQREDRLRHANDVLV
NDRDHAWLSSEVERLHHFYLTLRGGQS