Protein Info for Psyr_0697 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: tRNA 2-selenouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR03167: tRNA 2-selenouridine synthase" amino acids 15 to 347 (333 residues), 371.4 bits, see alignment E=2.1e-115

Best Hits

Swiss-Prot: 100% identical to SELU_PSEU2: tRNA 2-selenouridine/geranyl-2-thiouridine synthase (selU) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 100% identity to psb:Psyr_0697)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYK5 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Psyr_0697 tRNA 2-selenouridine synthase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MADNSSDYRALFLNDVPMMDARAPVEFSKGAFPGVINLPLMNDIERQKVGTCYKQHGQDA
AIQLGHQLVCGQVKDERVNAWIEFAKANPDGYLYCFRGGLRSQTVQRWLKDAGVDYPRVL
GGYKAMRTFLLDTLHEAVSECSIVVLGGMTGTGKTEVLTQLRNSVDLEGIANHRGSSFGK
RATGQPAQIDFENRLAIDLLKKRAAGIEQFVVEDESRLVGSCNVPLELHQAMQGCPMVWL
EDSFENRVERILEDYVINLCAEFITVKGEEQGFGLFAERLLQSLNNIHKRLGGERHQRLS
DLMQAALEEQQRSGAVDLHRGWIEGLLGEYYDPMYAYQREHKAARIEFAGDQTQVLAYLR
ERSEQR