Protein Info for Psyr_0667 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 45 to 273 (229 residues), 73.8 bits, see alignment E=7.6e-25

Best Hits

Swiss-Prot: 47% identical to FECB_ECOLI: Fe(3+) dicitrate-binding periplasmic protein (fecB) from Escherichia coli (strain K12)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_0667)

MetaCyc: 47% identical to ferric citrate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system, periplasmic iron-binding protein FecB (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYN5 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psyr_0667 Periplasmic binding protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRAFRLPHLLACGLLTLIASVAQAAPIDIDDGQHKVHLPDTPKRVVVLEFSFLDGLASVG
VTPVGAADDGDANRVLPKVRKAVGEWQSVGLRSQPNIEVIARLKPDLIIADLGRHQALYN
DLASLAPTLMLPSRGEDYQGSLKSAELIGVALGKGPQMQARIAENRQHLKTVAEQIPANS
NVLFGVAREDSFSVHGPHSYAGSVLQAIGLKVPEVRKNAAPTEFVSLEQLLALDPGWLLV
GHYRRPSIVDSWSKQPLWQVLGAVRNKQVAEVDGDSWARNRGIMASEQIADDALAVLKGG
KAVLNP