Protein Info for Psyr_0614 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00702: Hydrolase" amino acids 2 to 180 (179 residues), 95.8 bits, see alignment E=8.9e-31 PF13419: HAD_2" amino acids 5 to 186 (182 residues), 123.2 bits, see alignment E=2.8e-39 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 123 to 186 (64 residues), 51.3 bits, see alignment E=1.5e-17 PF13242: Hydrolase_like" amino acids 142 to 187 (46 residues), 31.4 bits, see alignment 2.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0614)

Predicted SEED Role

"Hydrolase in polyol utilization gene cluster, haloacid dehalogenase-like family" in subsystem Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYT8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Psyr_0614 HAD-superfamily hydrolase, subfamily IA, variant 3 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MIKAVIFDMDGVLIDAKEWHYDALNKALNLFGYNISRHEHLTAYDGLPTSRKLDMLSVER
DLPVALHAFINEMKQQYTMEIVYAQCKPTFVHQYALSSLKTLGYKLAVASNSIRNTVEVM
MNRADLDQYLDLRLSNEDVRHAKPAPDIYTKAISQLGLRPEECLIVEDNENGIKAARDSG
AHVLVVAETCDVNLNNILGKVEQINFDKAAVL