Protein Info for Psyr_0606 in Pseudomonas syringae pv. syringae B728a ΔmexB
Annotation: Exodeoxyribonuclease VII small subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EX7S_PSEU2: Exodeoxyribonuclease 7 small subunit (xseB) from Pseudomonas syringae pv. syringae (strain B728a)
KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 99% identity to pst:PSPTO_0700)MetaCyc: 46% identical to exodeoxyribonuclease VII subunit XseB (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]
Predicted SEED Role
"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)
Isozymes
Compare fitness of predicted isozymes for: 3.1.11.6
Use Curated BLAST to search for 3.1.11.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZYU6 at UniProt or InterPro
Protein Sequence (81 amino acids)
>Psyr_0606 Exodeoxyribonuclease VII small subunit (Pseudomonas syringae pv. syringae B728a ΔmexB) MARKKAALDFEQSLADLQALVERLENGELSLEDSLTAFEQGVRLTRDCQSALTQAEQKVQ VLLERDGELSEEPFDDAELPE